Structure of PDB 2vma Chain A |
>2vmaA (length=122) Species: 666 (Vibrio cholerae) [Search protein sequence] |
GFAFKRGISTPDLALITRQLATLVQSGMPLEECLRAVAEQSEKPRIRTML VAVRAKVTEGYTLSDSLGDYPHVFDELFRSMVAAGEKSGHLDSVLERLAD YAENRQKMRSKLQQASENLYPQ |
|
PDB | 2vma The Three-Dimensional Structure of the Cytoplasmic Domains of Epsf from the Type 2 Secretion System of Vibrio Cholerae. |
Chain | A |
Resolution | 1.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
E151 D155 |
E96 D100 |
|
|
|