Structure of PDB 2veg Chain A

Receptor sequence

>2vegA (length=279) Species: 1313 (Streptococcus pneumoniae)

HAKTVICGIINVTPFALEQALQQARKLIAEGASMLDIGGESSYVEIEEEI
QRVVPVIKAIRKESDVLISIDTWKSQVAEAALAAGADLVNDITGLMGDEK
MPHVVAEARAQVVIMFNPVMARPQHPSSLIFPHFGFAFTELADFETLPIE
ELMEAFFERALARAAEAGIAPENILLDPGIGFGLTKKENLLLLRDLDKLH
QKGYPIFLGVSRKRFVINILEENGFEVNPETELGFRNRDTASAHVTSIAA
RQGVEVVRVHDVASHRMAVEIASAIRLAD

3D structure

• PDB: 2veg Dihydropteroate Synthase from Streptococcus Pneumoniae: Structure, Ligand Recognition and Mechanism of Sulfonamide Resistance.
• Chain: A
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K237 R282
• Catalytic site (residue number reindexed from 1): K213 R258
• Enzyme Commision number: 2.5.1.15: dihydropteroate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PMM	A	N17 N110 I112 M135 D201 F206 K237 R282	N11 N90 I92 M115 D177 F182 K213 R258

Gene Ontology

Molecular Function

• GO:0004156 dihydropteroate synthase activity
• GO:0016740 transferase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009396 folic acid-containing compound biosynthetic process
• GO:0042558 pteridine-containing compound metabolic process
• GO:0044237 cellular metabolic process
• GO:0046654 tetrahydrofolate biosynthetic process
• GO:0046656 folic acid biosynthetic process
• GO:0046677 response to antibiotic

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:2veg, PDBe:2veg, PDBj:2veg
• PDBsum: 2veg
• PubMed: 18321242
• UniProt: P59655|DHPS_STRR6 Dihydropteroate synthase (Gene Name=sulA)