Structure of PDB 2vdg Chain A

Receptor sequence

>2vdgA (length=308) Species: 4513 (Hordeum vulgare)

QDHFVLKSGHAMPAVGLGTWRAGSDTAHSVRTAITEAGYRHVDTAAEYGV
EKEVGKGLKAAMEAGIDRKDLFVTSKIWCTNLAPERVRPALENTLKDLQL
DYIDLYHIHWPFRLKDGAHMPPEAGEVLEFDMEGVWKEMENLVKDGLVKD
IGVCNYTVTKLNRLLRSAKIPPAVCQMEMHPGWKNDKIFEACKKHGIHIT
AYSPLGSSEKNLAHDPVVEKVANKLNKTPGQVLIKWALQRGTSVIPKSSK
DERIKENIQVFGWEIPEEDFKVLCSIKDEKRVLTGEELFVNKTHGPYRSA
RDVWDHEN

3D structure

• PDB: 2vdg Barley Aldose Reductase: Structure, Cofactor Binding, and Substrate Recognition in the Aldo/Keto Reductase 4C Family.
• Chain: A
• Resolution: 1.92 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D55 Y60 K88 H121
• Catalytic site (residue number reindexed from 1): D43 Y48 K76 H109
• Enzyme Commision number: 1.1.1.21: aldose reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NDP	A	G30 T31 W32 D55 Y60 K88 H121 C166 N167 Q188 Y214 S215 P216 L217 S219 S220 N223 I257 P258 K259 S260 S261 K262 R265 E268 N269 L295	G18 T19 W20 D43 Y48 K76 H109 C154 N155 Q176 Y202 S203 P204 L205 S207 S208 N211 I245 P246 K247 S248 S249 K250 R253 E256 N257 L283
BS02	1BO	A	E59 L295	E47 L283
BS03	1BO	A	E135 A136 N303 H306	E123 A124 N291 H294

Gene Ontology

Molecular Function

• GO:0004032 aldose reductase (NADPH) activity
• GO:0016491 oxidoreductase activity

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:2vdg, PDBe:2vdg, PDBj:2vdg
• PDBsum: 2vdg
• PubMed: 18300247
• UniProt: P23901|ALDR_HORVU Aldose reductase