Structure of PDB 2vcn Chain A

Receptor sequence

>2vcnA (length=249) Species: 3847 (Glycine max)

GKSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAAHSAGTFDKGT
KTGGPFGTIKHPAELAHSANNGLDIAVRLLEPLKAEFPILSYADFYQLAG
VVAVEVTGGPEVPFHPGREDKPEPPPEGRLPDATKGSDHLRDVFGKAMGL
TDQDIVALSGGHTIGAAHKERSGFEGPWTSNPLIFDNSYFTELLSGEKEG
LLQLPSDKALLSDPVFRPLVDKYAADEDAFFADYAEAHQKLSELGFADA

3D structure

• PDB: 2vcn The Tuberculosis Prodrug Isoniazid Bound to Activating Peroxidases.
• Chain: A
• Resolution: 1.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R38 H42 L66 H163 W179 D208
• Catalytic site (residue number reindexed from 1): R37 H41 L65 H162 W178 D207
• Enzyme Commision number: 1.11.1.11: L-ascorbate peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	P34 P132 A134 L141 F145 L159 H163 G166 A167 A168 H169 R172 S173 W179 L205 S207	P33 P131 A133 L140 F144 L158 H162 G165 A166 A167 H168 R171 S172 W178 L204 S206
BS02	ISZ	A	A41 H42 G45 P132 F145	A40 H41 G44 P131 F144
BS03	ISZ	A	K30 L80	K29 L79
BS04	ISZ	A	R38 S69 A70 R172 S173	R37 S68 A69 R171 S172

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0016688 L-ascorbate peroxidase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006979 response to oxidative stress
• GO:0034599 cellular response to oxidative stress
• GO:0098869 cellular oxidant detoxification

External links

• PDB: RCSB:2vcn, PDBe:2vcn, PDBj:2vcn
• PDBsum: 2vcn
• PubMed: 18056997
• UniProt: Q43758