Structure of PDB 2vbn Chain A

Receptor sequence
>2vbnA (length=153) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
MNTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSSKFKHRLSLTFQVTQKTQ
RRWFLDKLVDEIGVGYVRDSGSVSNYILSEIKPLHNFLTQLQPFLKLKQK
QANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRA
VLD
3D structure
PDB2vbn Molecular Basis of Xeroderma Pigmentosum Group C DNA Recognition by Engineered Meganucleases
ChainA
Resolution1.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) G19 D20
Catalytic site (residue number reindexed from 1) G19 D20
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A D20 T46 Q47 K48 D20 T46 Q47 K48
BS02 dna A S32 K34 R38 Y66 R68 I81 D137 K139 S32 K34 R38 Y66 R68 I81 D137 K139
BS03 dna A G19 D20 S22 I24 Q26 K28 Q44 N136 D137 S138 T140 R141 K142 G19 D20 S22 I24 Q26 K28 Q44 N136 D137 S138 T140 R141 K142
BS04 CA A A134 N136 A134 N136
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2vbn, PDBe:2vbn, PDBj:2vbn
PDBsum2vbn
PubMed18987743
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]