Structure of PDB 2v8c Chain A

Receptor sequence
>2v8cA (length=139) Species: 10090 (Mus musculus) [Search protein sequence]
AGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMI
VGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNV
AVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
3D structure
PDB2v8c High-Resolution Structural Analysis of Mammalian Profilin 2A Complex Formation with Two Physiological Ligands: The Formin Homology 1 Domain of Mdia1 and the Proline-Rich Domain of Vasp.
ChainA
Resolution1.98 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 peptide A W3 Y6 N9 Y29 W31 M130 Y133 F139 W3 Y6 N9 Y29 W31 M130 Y133 F139
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0003785 actin monomer binding
GO:0005515 protein binding
GO:0005546 phosphatidylinositol-4,5-bisphosphate binding
GO:0016887 ATP hydrolysis activity
Biological Process
GO:0010633 negative regulation of epithelial cell migration
GO:0030036 actin cytoskeleton organization
GO:0030837 negative regulation of actin filament polymerization
GO:0030838 positive regulation of actin filament polymerization
GO:0032233 positive regulation of actin filament bundle assembly
GO:0032781 positive regulation of ATP-dependent activity
GO:0033138 positive regulation of peptidyl-serine phosphorylation
GO:0044087 regulation of cellular component biogenesis
GO:0050804 modulation of chemical synaptic transmission
GO:0050821 protein stabilization
GO:0051496 positive regulation of stress fiber assembly
GO:0098885 modification of postsynaptic actin cytoskeleton
GO:0099140 presynaptic actin cytoskeleton organization
GO:0099171 presynaptic modulation of chemical synaptic transmission
GO:0110053 regulation of actin filament organization
GO:1900028 negative regulation of ruffle assembly
GO:2000300 regulation of synaptic vesicle exocytosis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0098685 Schaffer collateral - CA1 synapse
GO:0098793 presynapse
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2v8c, PDBe:2v8c, PDBj:2v8c
PDBsum2v8c
PubMed18001770
UniProtQ9JJV2|PROF2_MOUSE Profilin-2 (Gene Name=Pfn2)

[Back to BioLiP]