Structure of PDB 2v89 Chain A

Receptor sequence
>2v89A (length=78) Species: 10090 (Mus musculus) [Search protein sequence]
SPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCM
DLEERTLIHLSEGSNKYYCNEHVQIARA
3D structure
PDB2v89 Rag2 Phd Finger Couples Histone H3 Lysine 4 Trimethylation with V(D)J Recombination.
ChainA
Resolution1.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A G1414 Y1415 T1436 A1442 M1443 I1444 Y1445 W1453 S1470 N1474 G5 Y6 T27 A33 M34 I35 Y36 W44 S61 N65
BS02 ZN A C1419 C1423 H1455 C1458 C10 C14 H46 C49
BS03 ZN A C1446 H1452 C1478 H1481 C37 H43 C69 H72
Gene Ontology
Biological Process
GO:0006310 DNA recombination
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2v89, PDBe:2v89, PDBj:2v89
PDBsum2v89
PubMed18033247
UniProtP21784|RAG2_MOUSE V(D)J recombination-activating protein 2 (Gene Name=Rag2)

[Back to BioLiP]