Structure of PDB 2v87 Chain A

Receptor sequence
>2v87A (length=77) Species: 10090 (Mus musculus) [Search protein sequence]
SPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCM
DLEERTLIHLSEGSNKYYCNEHVQIAR
3D structure
PDB2v87 The Plant Homeodomain Finger of Rag2 Recognizes Histone H3 Methylated at Both Lysine-4 and Arginine-2.
ChainA
Resolution1.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A G414 Y415 T436 A442 M443 Y445 W453 L469 S470 G472 N474 G5 Y6 T27 A33 M34 Y36 W44 L60 S61 G63 N65
BS02 peptide A C420 P421 T422 D424 T429 C11 P12 T13 D15 T20
BS03 ZN A C419 C423 H455 C458 C10 C14 H46 C49
BS04 ZN A C446 H452 C478 H481 C37 H43 C69 H72
Gene Ontology
Biological Process
GO:0006310 DNA recombination
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2v87, PDBe:2v87, PDBj:2v87
PDBsum2v87
PubMed18025461
UniProtP21784|RAG2_MOUSE V(D)J recombination-activating protein 2 (Gene Name=Rag2)

[Back to BioLiP]