Structure of PDB 2v27 Chain A |
>2v27A (length=264) Species: 167879 (Colwellia psychrerythraea 34H) [Search protein sequence] |
GTKYVSKVPDEHGFIEWSTEENLIWQELFTRQIACIKDKACDEYHEGLAK LNLPTDRIPQLDEVSKVLKVSTGWECYPVPALIGFGEFFRLLSEKKFPVA TFIRSREEMDYLQEPDIFHEIFGHCPLLTNSSFANYTEAYGKMGLNATKE QRVFLARLYWFTIEFGLLDTPKGLRIYGGGVLSSPGETDYAMNNTDVDRK PFDILDVLRTPYRIDIMQPIYYMLTKVSDLDEIRKFEVDDIMELVAQAEA LGLHEAKFPVKKAS |
|
PDB | 2v27 Structure of Phenylalanine Hydroxylase from Colwellia Psychrerythraea 34H, a Monomeric Cold Active Enzyme with Local Flexibility Around the Active Site and High Overall Stability. |
Chain | A |
Resolution | 1.5 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
A |
H122 H127 E167 |
H119 H124 E164 |
|
|
|
Molecular Function |
GO:0004497 |
monooxygenase activity |
GO:0004505 |
phenylalanine 4-monooxygenase activity |
GO:0005506 |
iron ion binding |
GO:0016714 |
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen |
GO:0046872 |
metal ion binding |
|
|