Structure of PDB 2v1c Chain A |
>2v1cA (length=198) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539) [Search protein sequence] |
KYPPSLVSLIRELSRLPGIGPKSAQRLAFHLFEQPREDIERLASALLEAK RDLHVCPICFNITDAEKCDVCADPSRDQRTICVVEEPGDVIALERSGEYR GLYHVLHGVLSPMNGVGPDKLHIKPLLPRVGQGMEVILATGTTVEGDATA LYLQRLLEPLGAAISRIAYGVPVGGSLEYTDEVTLGRALTGRQTVSKP |
|
PDB | 2v1c Crystal Structure and Mutational Study of Recor Provide Insight Into its Mode of DNA Binding. |
Chain | A |
Resolution | 3.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C57 C60 C69 C72 |
C56 C59 C68 C71 |
|
|
|
|