Structure of PDB 2v18 Chain A

Receptor sequence

>2v18A (length=67) Species: 300852 (Thermus thermophilus HB8)

GKVYKKVELVGTSEEGLEAAIQAALARARKTLRHLDWFEVKEIRGTIGEA
GVKEYQVVLEVGFRLEE

3D structure

• PDB: 2v18 The Dodecin from Thermus Thermophilus, a Bifunctional Cofactor Storage Protein.
• Chain: A
• Resolution: 2.59 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FMN	A	K3 Y5 D37 W38 R65	K2 Y4 D36 W37 R64
BS02	FMN	A	R45 T47 Q57	R44 T46 Q56
BS03	FMN	A	V11 Q57	V10 Q56

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding

External links

• PDB: RCSB:2v18, PDBe:2v18, PDBj:2v18
• PDBsum: 2v18
• PubMed: 17855371
• UniProt: Q5SIE3|DODEC_THET8 Dodecin (Gene Name=TTHA1431)