Structure of PDB 2v08 Chain A

Receptor sequence
>2v08A (length=84) Species: 32059 (Phormidium laminosum) [Search protein sequence]
DLATGAKVFSANCAACHAGGINLVNAEKTLKKEALEKFGMNSIVAITTQV
TNGKAGMPAFKGRLTDDQIAAVAAYVLDQAEKGW
3D structure
PDB2v08 Modulation of heme redox potential in the cytochrome c6 family.
ChainA
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEC A N14 C15 C18 H19 N24 V26 K30 T31 L32 F40 Q51 K56 G58 M59 P60 F62 N12 C13 C16 H17 N22 V24 K28 T29 L30 F38 Q49 K54 G56 M57 P58 F60
BS02 ZN A N27 E29 N25 E27
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0009579 thylakoid
GO:0031977 thylakoid lumen
GO:0031979 plasma membrane-derived thylakoid lumen

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2v08, PDBe:2v08, PDBj:2v08
PDBsum2v08
PubMed17625855
UniProtF2Z292

[Back to BioLiP]