Structure of PDB 2ux7 Chain A |
>2ux7A (length=122) Species: 223 (Achromobacter cycloclastes) [Search protein sequence] |
ADFEVHMLNKGKDGAMVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIP DGAEAFKSKINENYKVTFTAPGVYGVKCTPHPFMVGVVQVGDAPANLEAV KGAKNPKKAQERLDAALAALGN |
|
PDB | 2ux7 Influence of loop shortening on the metal binding site of cupredoxin pseudoazurin. |
Chain | A |
Resolution | 1.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H40 C78 H81 M84 |
H40 C78 H81 M84 |
|
|
|
|