Structure of PDB 2uuq Chain A

Receptor sequence

>2uuqA (length=394) Species: 83332 (Mycobacterium tuberculosis H37Rv)

SHEFQLATAETWPNPWPMYRALRDHDPVHHVVPPQRPEYDYYVLSRHADV
WSAARDHQTFSSAQGLTVNYGELEMIGLHDTPPMVMQDPPVHTEFRKLVS
RGFTPRQVETVEPTVRKFVVERLEKLRANGGGDIVTELFKPLPSMVVAHY
LGVPEEDWTQFDGWTQAIVAANAVGALDAVGSMMAYFTGLIERRRTEPAD
DAISHLVAAGVGADGDTAGTLSILAFTFTMVTGGNDTVTGMLGGSMPLLH
RRPDQRRLLLDDPEGIPDAVEELLRLTSPVQGLARTTTRDVTIGDTTIPA
GRRVLLLYGSANRDERQYGPDAAELDVTRCPRNILTFSHGAHHCLGAAAA
RMQCRVALTELLARCPDFEVAESRIVWSGGSYVRRPLSVPFRVT

3D structure

• PDB: 2uuq Mycobacterium Tuberculosis Cyp130:Crystal Mycobacterium Tuberculosis Cyp130: Crystal Structure, Biophysical Characterization, and Interactions with Antifungal Azole Drugs.
• Chain: A
• Resolution: 1.46 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): A175 G243 D246 T247 V248 C354 L355 G356 Q363 V393
• Catalytic site (residue number reindexed from 1): A170 G233 D236 T237 V238 C344 L345 G346 Q353 V383
• Enzyme Commision number: 1.14.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	M89 V90 H97 R101 M240 G244 T247 L293 R295 Y318 T346 F347 S348 H352 C354 G356 A360	M84 V85 H92 R96 M230 G234 T237 L283 R285 Y308 T336 F337 S338 H342 C344 G346 A350

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Cellular Component

• GO:0009274 peptidoglycan-based cell wall

External links

• PDB: RCSB:2uuq, PDBe:2uuq, PDBj:2uuq
• PDBsum: 2uuq
• PubMed: 18089574
• UniProt: P9WPN5|CP130_MYCTU Cytochrome P450 130 (Gene Name=cyp130)