Structure of PDB 2tn4 Chain A

Receptor sequence
>2tn4A (length=155) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
TDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTP
TKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAELFR
IFDRNADGYIDAEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDE
FLKMM
3D structure
PDB2tn4 Structures of four Ca2+-bound troponin C at 2.0 A resolution: further insights into the Ca2+-switch in the calmodulin superfamily.
ChainA
Resolution2.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) V42
Catalytic site (residue number reindexed from 1) V42
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A D27 D29 D33 E38 D27 D29 D33 E38
BS02 CA A D63 D65 S67 T69 E74 D63 D65 S67 T69 E74
BS03 CA A D103 N105 D107 Y109 E114 D103 N105 D107 Y109 E114
BS04 CA A D139 N141 D143 R145 E150 D139 N141 D143 R145 E150
BS05 CA A D56 E60 D56 E60
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0031014 troponin T binding
GO:0046872 metal ion binding
Cellular Component
GO:0016460 myosin II complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2tn4, PDBe:2tn4, PDBj:2tn4
PDBsum2tn4
PubMed9438870
UniProtP02586|TNNC2_RABIT Troponin C, skeletal muscle (Gene Name=TNNC2)

[Back to BioLiP]