Structure of PDB 2tdt Chain A

Receptor sequence

>2tdtA (length=274) Species: 1765 (Mycobacterium tuberculosis variant bovis)

MQQLQNVIESAFERRADITPANVDTVTREAVNQVIGLLDSGALRVAEKID
GQWVTHQWLKKAVLLSFRINDNKVMDGAETRYYDKVPMKFADYDEARFQK
EGFRVVPPATVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCA
QIGKNVHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGS
VISMGVYLGQSTRIYDRETGEIHYGRVPAGSVVVSGNLPSKDGSYSLYCA
VIVKKVDAKTRGKVGINELLRTID

3D structure

• PDB: 2tdt The conformational change and active site structure of tetrahydrodipicolinate N-succinyltransferase.
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D141 G166 E189
• Catalytic site (residue number reindexed from 1): D141 G166 E189
• Enzyme Commision number: 2.3.1.117: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	COA	A	S159 F183 G185 S203 M204 R217 K254 K259 T260 K263	S159 F183 G185 S203 M204 R217 K254 K259 T260 K263
BS02	NPI	A	R104 M124 M139 D141	R104 M124 M139 D141

Gene Ontology

Molecular Function

• GO:0008666 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase activity
• GO:0016740 transferase activity
• GO:0016746 acyltransferase activity
• GO:0016779 nucleotidyltransferase activity

Biological Process

• GO:0009085 lysine biosynthetic process
• GO:0009089 lysine biosynthetic process via diaminopimelate
• GO:0019877 diaminopimelate biosynthetic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2tdt, PDBe:2tdt, PDBj:2tdt
• PDBsum: 2tdt
• PubMed: 9671504
• UniProt: P56220|DAPD_UNKP 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (Gene Name=dapD)