Structure of PDB 2tcl Chain A

Receptor sequence
>2tclA (length=163) Species: 9606 (Homo sapiens) [Search protein sequence]
LTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTK
VSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDE
RWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQD
DIDGIQAIYGRSQ
3D structure
PDB2tcl Structure of the catalytic domain of human fibroblast collagenase complexed with an inhibitor.
ChainA
Resolution2.2 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H118 E119 H122 H128
Catalytic site (residue number reindexed from 1) H117 E118 H121 H127
Enzyme Commision number 3.4.24.7: interstitial collagenase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A H118 H122 H128 H117 H121 H127
BS02 ZN A H68 D70 H83 H96 H67 D69 H82 H95
BS03 CA A D75 G76 G78 N80 D98 E101 D74 G75 G77 N79 D97 E100
BS04 CA A D58 G90 G92 D94 D57 G89 G91 D93
BS05 RO4 A G79 L81 A82 H118 E119 H122 H128 P138 S139 Y140 G78 L80 A81 H117 E118 H121 H127 P137 S138 Y139 MOAD: ic50=9nM
BindingDB: IC50=40nM
Gene Ontology
Molecular Function
GO:0004222 metalloendopeptidase activity
GO:0008237 metallopeptidase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0031012 extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2tcl, PDBe:2tcl, PDBj:2tcl
PDBsum2tcl
PubMed7656013
UniProtP03956|MMP1_HUMAN Interstitial collagenase (Gene Name=MMP1)

[Back to BioLiP]