Structure of PDB 2sar Chain A

Receptor sequence
>2sarA (length=96) Species: 1894 (Kitasatospora aureofaciens) [Search protein sequence]
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYG
YYHEYTVITPGARTRGTRRIICGEATQEDYYTGDHYATFSLIDQTC
3D structure
PDB2sar Determination and restrained least-squares refinement of the structures of ribonuclease Sa and its complex with 3'-guanylic acid at 1.8 A resolution.
ChainA
Resolution1.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) E54 R65 R69 H85
Catalytic site (residue number reindexed from 1) E54 R65 R69 H85
Enzyme Commision number 4.6.1.24: ribonuclease T1.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 3GP A Q32 F37 Q38 N39 R40 E41 E54 R65 R69 H85 Y86 Q32 F37 Q38 N39 R40 E41 E54 R65 R69 H85 Y86
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0004540 RNA nuclease activity
GO:0016829 lyase activity
GO:0046589 ribonuclease T1 activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2sar, PDBe:2sar, PDBj:2sar
PDBsum2sar
PubMed1654932
UniProtP05798|RNSA_KITAU Guanyl-specific ribonuclease Sa (Gene Name=rnaSA)

[Back to BioLiP]