Structure of PDB 2sam Chain A

Receptor sequence

>2samA (length=99) Species: 11723 (Simian immunodeficiency virus)

PQFHLWKRPVVTAHIEGQPVEVLLDTGADDSIVTGIELGPHYTPKIVGGI
GGFINTKEYKNVEIEVLGKRIKGTIMTGDTPINIFGRNLLTALGMSLNF

3D structure

• PDB: 2sam Structure of the protease from simian immunodeficiency virus: complex with an irreversible nonpeptide inhibitor.
• Chain: A
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D25 T26 G27
• Catalytic site (residue number reindexed from 1): D25 T26 G27
• Enzyme Commision number: 3.1.13.2: exoribonuclease H.
  3.1.26.13: retroviral ribonuclease H.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	EPN	A	D25 I82	D25 I82

Gene Ontology

Molecular Function

• GO:0004190 aspartic-type endopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:2sam, PDBe:2sam, PDBj:2sam
• PDBsum: 2sam
• PubMed: 8241141
• UniProt: Q5QGH9