Structure of PDB 2rsq Chain A |
>2rsqA (length=71) Species: 9606 (Homo sapiens) [Search protein sequence] |
GTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLP SQEVQALLEGTGRQAVLKGMG |
|
PDB | 2rsq Copper(I) loaded form of the first domain of the human copper chaperone for SOD1, CCS |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU1 |
A |
C22 C25 |
C14 C17 |
|
|
|
|