Structure of PDB 2rs2 Chain A |
>2rs2A (length=84) Species: 10090 (Mus musculus) [Search protein sequence] |
CKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFM DQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPK |
|
PDB | 2rs2 Structure of Musashi1 in a complex with target RNA: the role of aromatic stacking interactions |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
Q42 |
Catalytic site (residue number reindexed from 1) |
Q23 |
Enzyme Commision number |
? |
|
|
|
|