Structure of PDB 2rpq Chain A

Receptor sequence
>2rpqA (length=93) Species: 9606 (Homo sapiens) [Search protein sequence]
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCER
QGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
3D structure
PDB2rpq Structure of the small ubiquitin-like modifier (SUMO)-interacting motif of MBD1-containing chromatin-associated factor 1 bound to SUMO-3
ChainA
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A E4 N15 H17 V30 Q31 F32 K33 I34 K35 H37 T38 K42 R50 E4 N15 H17 V30 Q31 F32 K33 I34 K35 H37 T38 K42 R50
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0031386 protein tag activity
GO:0031625 ubiquitin protein ligase binding
GO:0044389 ubiquitin-like protein ligase binding
Biological Process
GO:0016925 protein sumoylation
GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0016605 PML body

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2rpq, PDBe:2rpq, PDBj:2rpq
PDBsum2rpq
PubMed18842587
UniProtP61956|SUMO2_HUMAN Small ubiquitin-related modifier 2 (Gene Name=SUMO2)

[Back to BioLiP]