Structure of PDB 2rok Chain A

Receptor sequence

>2rokA (length=100) Species: 10090 (Mus musculus)

GSSGSSGGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDT
SAFVSLSQPEQVQIAVNTSKYAESYRIQTYAEYVGKKQKGKQVKSGPSSG

3D structure

• PDB: 2rok The RRM domain of poly(A)-specific ribonuclease has a noncanonical binding site for mRNA cap analog recognition.
• Chain: A
• Resolution: N/A

Enzymatic activity

• Enzyme Commision number: 3.1.13.4: poly(A)-specific ribonuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	7MG	A	W449 K450 W468 D470	W27 K28 W46 D48	PDBbind-CN: -logKd/Ki=4.35,Kd=45uM
BS02	GDP	A	K447 D471	K25 D49	PDBbind-CN: -logKd/Ki=4.35,Kd=45uM

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0004535 poly(A)-specific ribonuclease activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006402 mRNA catabolic process

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:2rok, PDBe:2rok, PDBj:2rok
• PDBsum: 2rok
• PubMed: 18641416
• UniProt: Q8VDG3|PARN_MOUSE Poly(A)-specific ribonuclease PARN (Gene Name=Parn)