Structure of PDB 2rnf Chain A

Receptor sequence
>2rnfA (length=120) Species: 9606 (Homo sapiens) [Search protein sequence]
MQDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHED
IWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIAS
TRRVVIACEGNPQVPVHFDG
3D structure
PDB2rnf The three-dimensional structure of human RNase 4, unliganded and complexed with d(Up), reveals the basis for its uridine selectivity.
ChainA
Resolution2.4 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H12 K40 H116 F117 D118
Catalytic site (residue number reindexed from 1) H13 K41 H117 F118 D119
Enzyme Commision number 3.1.27.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 UM3 A Q11 H12 K40 F42 N43 T44 F117 Q12 H13 K41 F43 N44 T45 F118
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004519 endonuclease activity
GO:0004522 ribonuclease A activity
GO:0004540 RNA nuclease activity
Biological Process
GO:0019731 antibacterial humoral response
GO:0042742 defense response to bacterium
GO:0050830 defense response to Gram-positive bacterium
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2rnf, PDBe:2rnf, PDBj:2rnf
PDBsum2rnf
PubMed9878400
UniProtP34096|RNAS4_HUMAN Ribonuclease 4 (Gene Name=RNASE4)

[Back to BioLiP]