Structure of PDB 2rnb Chain A

Receptor sequence

>2rnbA (length=67) Species: 9606 (Homo sapiens)

GSFTMPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCG
HLIEAHKECMRALGFKI

3D structure

• PDB: 2rnb A structural-dynamical characterization of human cox17
• Chain: A
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CU1	A	C27 C28	C27 C28

Gene Ontology

Molecular Function

• GO:0005507 copper ion binding
• GO:0005515 protein binding
• GO:0008047 enzyme activator activity
• GO:0016531 copper chaperone activity
• GO:0046872 metal ion binding
• GO:1903136 cuprous ion binding

Biological Process

• GO:0006091 generation of precursor metabolites and energy
• GO:0006825 copper ion transport
• GO:0008284 positive regulation of cell population proliferation
• GO:0033617 mitochondrial cytochrome c oxidase assembly
• GO:1904960 positive regulation of cytochrome-c oxidase activity

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space

External links

• PDB: RCSB:2rnb, PDBe:2rnb, PDBj:2rnb
• PDBsum: 2rnb
• PubMed: 18093982
• UniProt: Q14061|COX17_HUMAN Cytochrome c oxidase copper chaperone (Gene Name=COX17)