Structure of PDB 2rkn Chain A

Receptor sequence

>2rknA (length=77) Species: 3702 (Arabidopsis thaliana)

AIDLCGMSQDELNECKPAVSKENPTSPSQPCCTALQHADFACLCGYKNSP
WLGSFGVDPELASALPKQCGLANAPTC

3D structure

• PDB: 2rkn The structure of "defective in induced resistance" protein of Arabidopsis thaliana, DIR1, reveals a new type of lipid transfer protein.
• Chain: A
• Resolution: 1.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	E11 H37	E11 H37
BS02	ZN	A	E11 H37	E11 H37
BS03	LP3	A	N13 K16 F40 L43 F55 P75	N13 K16 F40 L43 F55 P75	MOAD: Kd=0.06uM PDBbind-CN: -logKd/Ki=7.22,Kd=0.06uM
BS04	LP3	A	Q9 K47 W51 P59 A62 S63 C77	Q9 K47 W51 P59 A62 S63 C77	MOAD: Kd=0.06uM PDBbind-CN: -logKd/Ki=7.22,Kd=0.06uM

Gene Ontology

Molecular Function

• GO:0005504 fatty acid binding
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0008289 lipid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006869 lipid transport
• GO:0006952 defense response
• GO:0009627 systemic acquired resistance
• GO:0009862 systemic acquired resistance, salicylic acid mediated signaling pathway

Cellular Component

• GO:0005783 endoplasmic reticulum
• GO:0009506 plasmodesma
• GO:0048046 apoplast
• GO:0070161 anchoring junction
• GO:0099503 secretory vesicle

External links

• PDB: RCSB:2rkn, PDBe:2rkn, PDBj:2rkn
• PDBsum: 2rkn
• PubMed: 18552128
• UniProt: Q8W453|DIRL1_ARATH Putative lipid-transfer protein DIR1 (Gene Name=DIR1)