Structure of PDB 2rkf Chain A |
>2rkfA (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWQRPFVTVKIAGQLMEALLDTGADDTILEEMSLPGRWTPKVVGGI GGFMKVRQYDQILVEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF |
|
PDB | 2rkf Ninety-nine is not enough: molecular characterization of inhibitor-resistant human immunodeficiency virus type 1 protease mutants with insertions in the flap region |
Chain | A |
Resolution | 1.8 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
D25 T26 G27 |
Catalytic site (residue number reindexed from 1) |
D25 T26 G27 |
Enzyme Commision number |
3.1.26.13: retroviral ribonuclease H. |
|
|
|
|