Structure of PDB 2rct Chain A

Receptor sequence

>2rctA (length=141) Species: 9606 (Homo sapiens)

MRGSTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDG
DNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCV
QKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKKLVPR

3D structure

• PDB: 2rct Crystal structure of human cellular retinol-binding protein II to 1.2 A resolution.
• Chain: A
• Resolution: 1.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	RTL	A	F16 M20 Q38 T51 V62 L77 W106 L117	F20 M24 Q42 T55 V66 L81 W110 L121

Gene Ontology

Molecular Function

• GO:0005501 retinoid binding
• GO:0005504 fatty acid binding
• GO:0008289 lipid binding
• GO:0016918 retinal binding
• GO:0019841 retinol binding

Biological Process

• GO:0006776 vitamin A metabolic process
• GO:0008544 epidermis development
• GO:0015908 fatty acid transport

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:2rct, PDBe:2rct, PDBj:2rct
• PDBsum: 2rct
• PubMed: 18076076
• UniProt: P50120|RET2_HUMAN Retinol-binding protein 2 (Gene Name=RBP2)