Structure of PDB 2raq Chain A |
>2raqA (length=93) Species: 187420 (Methanothermobacter thermautotrophicus str. Delta H) [Search protein sequence] |
AKGLIRIVLDILKPHEPIIPEYAKYLSELRGVEGVNITLMEIDKETENIK VTIQGNDLDFDEITRAIESYGGSIHSVDEVVAGRTMVEEVTTP |
|
PDB | 2raq Crystal structure of the MTH889 protein from Methanothermobacter thermautotrophicus. |
Chain | A |
Resolution | 3.11 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
E43 D45 |
E41 D43 |
|
BS02 |
CA |
A |
D12 S78 |
D10 S76 |
|
|
|
|