Structure of PDB 2r8h Chain A

Receptor sequence

>2r8hA (length=341) Species: 2287 (Saccharolobus solfataricus)

MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

3D structure

• PDB: 2r8h Insertion of dNTPs opposite the 1,N2-propanodeoxyguanosine adduct by Sulfolobus solfataricus P2 DNA polymerase IV
• Chain: A
• Resolution: 2.48 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	P184 G185 G187 I189 T190 S297 R298 T301 K339	P184 G185 G187 I189 T190 S297 R298 T301 K339
BS02	dna	A	V32 F37 S40 G41 P60 K78 G218 E219 A220 R242 K243 S244 I245 G246 R247 I248 T250 R331 R332	V32 F37 S40 G41 P60 K78 G218 E219 A220 R242 K243 S244 I245 G246 R247 I248 T250 R331 R332
BS03	CA	A	A181 I186	A181 I186
BS04	CA	A	D7 E106	D7 E106
BS05	CA	A	D7 F8 D105	D7 F8 D105
BS06	DGT	A	Y10 F11 Y12 A44 R51 D105 K159	Y10 F11 Y12 A44 R51 D105 K159

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2r8h, PDBe:2r8h, PDBj:2r8h
• PDBsum: 2r8h
• PubMed: 18563918
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)