Structure of PDB 2r8d Chain A |
>2r8dA (length=79) Species: 183190 (Xylella fastidiosa Temecula1) [Search protein sequence] |
ALMVTREDGSFLIDGTLPIEELREVLGAENNYHTLAGMCISYFGRIPHVG EYFDWAGWRIEIVDLDGARIDKLLLQRLN |
|
PDB | 2r8d The structure of transporter associated domain CorC in complex with Mg++ and Mn++ from Xylella fastidiosa. |
Chain | A |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MN |
A |
D76 D78 D83 |
D64 D66 D71 |
|
|
|
|