Structure of PDB 2r74 Chain A |
>2r74A (length=142) Species: 9337 (Trichosurus vulpecula) [Search protein sequence] |
LRHWHTVVLASSDRSLIEEEGPFRNFIQNITVESGNLNGFFLTRKNGQCI PLYLTAFKTEEARQFKLNYYGTNDVYYESSKPNEYAKFIFYNYHDGKVNV VANLFGRTPNLSNEIKKRFEEDFMNRGFRRENILDISEVDHC |
|
PDB | 2r74 Three-dimensional structure and ligand binding properties of trichosurin, a metatherian lipocalin from the milk whey of the common brushtail possum Trichosurus vulpecula |
Chain | A |
Resolution | 1.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H27 H29 |
H3 H5 |
|
|
|
|