Structure of PDB 2r6m Chain A

Receptor sequence
>2r6mA (length=176) Species: 10116 (Rattus norvegicus) [Search protein sequence]
VSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDL
EQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCEN
QPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHM
LFMVHPEYRPKRPANQFVPRLYGFKI
3D structure
PDB2r6m Crystal structures of catalytic and regulatory subunits of rat protein kinase CK2
ChainA
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A C109 C114 C137 C140 C93 C98 C121 C124
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
GO:0004674 protein serine/threonine kinase activity
GO:0005102 signaling receptor binding
GO:0019887 protein kinase regulator activity
GO:0019904 protein domain specific binding
GO:0030674 protein-macromolecule adaptor activity
GO:0042802 identical protein binding
GO:0043021 ribonucleoprotein complex binding
GO:0046872 metal ion binding
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
Biological Process
GO:0016055 Wnt signaling pathway
GO:0032435 negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032927 positive regulation of activin receptor signaling pathway
GO:0033211 adiponectin-activated signaling pathway
GO:0033574 response to testosterone
GO:0043537 negative regulation of blood vessel endothelial cell migration
GO:0060391 positive regulation of SMAD protein signal transduction
GO:0061154 endothelial tube morphogenesis
GO:0075342 symbiont-mediated disruption of host cell PML body
GO:0097421 liver regeneration
GO:1903901 negative regulation of viral life cycle
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0005956 protein kinase CK2 complex
GO:0016363 nuclear matrix
GO:0016605 PML body
GO:0031519 PcG protein complex
GO:0042995 cell projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2r6m, PDBe:2r6m, PDBj:2r6m
PDBsum2r6m
PubMed
UniProtP67874|CSK2B_RAT Casein kinase II subunit beta (Gene Name=Csnk2b)

[Back to BioLiP]