Structure of PDB 2r5y Chain A

Receptor sequence
>2r5yA (length=73) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
GKKNPPQIYPWMKRVQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHAL
SLTERQIKIWFQNRRMKWKKEHK
3D structure
PDB2r5y Functional specificity of a Hox protein mediated by the recognition of minor groove structure
ChainA
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R105 T106 Y108 R143 Q144 I147 N151 R17 T18 Y20 R55 Q56 I59 N63 PDBbind-CN: Kd=10.3nM
BS02 dna A V88 R105 Y125 R128 R131 Q150 R153 M154 K157 V15 R17 Y37 R40 R43 Q62 R65 M66 K69 PDBbind-CN: Kd=10.3nM
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2r5y, PDBe:2r5y, PDBj:2r5y
PDBsum2r5y
PubMed17981120
UniProtP09077|SCR_DROME Homeotic protein Sex combs reduced (Gene Name=Scr)

[Back to BioLiP]