Structure of PDB 2qt7 Chain A |
>2qt7A (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] |
EEYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRI RHNEQNLSLADVTQQAGLVKSELEAQTGLQILQTGVGQR |
|
PDB | 2qt7 Structure of the Mature Ectodomain of the Human Receptor-type Protein-tyrosine Phosphatase IA-2 |
Chain | A |
Resolution | 1.3 Å |
3D structure |
|
|
Enzyme Commision number |
3.1.3.48: protein-tyrosine-phosphatase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
N76 D81 |
N56 D61 |
|
BS02 |
CA |
A |
E94 Q100 |
E74 Q80 |
|
|
|
|