Structure of PDB 2qq0 Chain A

Receptor sequence
>2qq0A (length=169) Species: 2336 (Thermotoga maritima) [Search protein sequence]
SGKLTVITGPMYSGKTTELLSFVEIYKLGKKKVAVFKPKTMIVSHVEAHV
IERPEEMRKYIEEDTRGVFIDEVQFFNPSLFEVVKDLLDRGIDVFCAGLD
LTHKQNPFETTALLLSLADTVIKKKAVCHRCGEYNATLTLKVAGGEEEID
VGGQEKYIAVCRDCYNTLK
3D structure
PDB2qq0 Quaternary structure change as a mechanism for the regulation of thymidine kinase 1-like enzymes.
ChainA
Resolution1.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.1.21: thymidine kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A C140 C143 C173 C176 C128 C131 C161 C164
BS02 THM A M12 E84 F87 L111 T114 H115 T151 E160 D162 V163 G164 Y169 M11 E72 F75 L99 T102 H103 T139 E148 D150 V151 G152 Y157
BS03 ANP A M12 Y13 S14 G15 K16 T17 T18 S52 H53 A138 V139 M11 Y12 S13 G14 K15 T16 T17 S44 H45 A126 V127
Gene Ontology
Molecular Function
GO:0004797 thymidine kinase activity
GO:0005524 ATP binding
GO:0008270 zinc ion binding
GO:0016301 kinase activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006259 DNA metabolic process
GO:0009157 deoxyribonucleoside monophosphate biosynthetic process
GO:0016310 phosphorylation
GO:0046104 thymidine metabolic process
GO:0071897 DNA biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2qq0, PDBe:2qq0, PDBj:2qq0
PDBsum2qq0
PubMed18073106
UniProtQ9WYN2|KITH_THEMA Thymidine kinase (Gene Name=tdk)

[Back to BioLiP]