Structure of PDB 2qmp Chain A

Receptor sequence

>2qmpA (length=99) Species: 11676 (Human immunodeficiency virus 1)

PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGI
GGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

3D structure

• PDB: 2qmp Crystal Structure of HIV-1 protease complexed with PL-100
• Chain: A
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D25 T26 G27
• Catalytic site (residue number reindexed from 1): D25 T26 G27
• Enzyme Commision number: 3.4.23.16: HIV-1 retropepsin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	A00	A	D25 G27 D29 G48 G49 I50 I84	D25 G27 D29 G48 G49 I50 I84
BS02	A00	A	R8 D25 G48 G49 I50	R8 D25 G48 G49 I50

Gene Ontology

Molecular Function

• GO:0004190 aspartic-type endopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:2qmp, PDBe:2qmp, PDBj:2qmp
• PDBsum: 2qmp
• UniProt: Q9WFL7