Structure of PDB 2qme Chain A

Receptor sequence
>2qmeA (length=178) Species: 9606 (Homo sapiens) [Search protein sequence]
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKP
VNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPE
VRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIG
SVKYLECSALTQRGLKTVFDEAIRAVLG
3D structure
PDB2qme The crystal structure of the human RAC3 in complex with the CRIB domain of human p21-activated kinase 1 (PAK1).
ChainA
Resolution1.75 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A Y23 T24 T25 V36 F37 D38 N39 Y40 S41 A42 N43 V44 M45 V46 D47 K166 D170 Y23 T24 T25 V36 F37 D38 N39 Y40 S41 A42 N43 V44 M45 V46 D47 K166 D170
BS02 MG A T17 T35 T17 T35
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019901 protein kinase binding
GO:0048306 calcium-dependent protein binding
Biological Process
GO:0007015 actin filament organization
GO:0007163 establishment or maintenance of cell polarity
GO:0007264 small GTPase-mediated signal transduction
GO:0008045 motor neuron axon guidance
GO:0008360 regulation of cell shape
GO:0014041 regulation of neuron maturation
GO:0016055 Wnt signaling pathway
GO:0016601 Rac protein signal transduction
GO:0021894 cerebral cortex GABAergic interneuron development
GO:0022604 regulation of cell morphogenesis
GO:0030031 cell projection assembly
GO:0030036 actin cytoskeleton organization
GO:0030865 cortical cytoskeleton organization
GO:0031175 neuron projection development
GO:0032956 regulation of actin cytoskeleton organization
GO:0033630 positive regulation of cell adhesion mediated by integrin
GO:0035556 intracellular signal transduction
GO:0043652 engulfment of apoptotic cell
GO:0045730 respiratory burst
GO:0048873 homeostasis of number of cells within a tissue
GO:0050885 neuromuscular process controlling balance
GO:0050905 neuromuscular process
GO:0051932 synaptic transmission, GABAergic
GO:0060326 cell chemotaxis
GO:0098974 postsynaptic actin cytoskeleton organization
GO:0150052 regulation of postsynapse assembly
GO:1900026 positive regulation of substrate adhesion-dependent cell spreading
GO:1902622 regulation of neutrophil migration
Cellular Component
GO:0005737 cytoplasm
GO:0005789 endoplasmic reticulum membrane
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0012505 endomembrane system
GO:0030027 lamellipodium
GO:0030426 growth cone
GO:0031410 cytoplasmic vesicle
GO:0031941 filamentous actin
GO:0042995 cell projection
GO:0043005 neuron projection
GO:0043020 NADPH oxidase complex
GO:0043025 neuronal cell body
GO:0048471 perinuclear region of cytoplasm
GO:0070062 extracellular exosome
GO:0071944 cell periphery
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2qme, PDBe:2qme, PDBj:2qme
PDBsum2qme
PubMed
UniProtP60763|RAC3_HUMAN Ras-related C3 botulinum toxin substrate 3 (Gene Name=RAC3)

[Back to BioLiP]