Structure of PDB 2qi3 Chain A |
>2qi3A (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGI GGFIKVRQYDQIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
|
PDB | 2qi3 HIV-1 protease inhibitors from inverse design in the substrate envelope exhibit subnanomolar binding to drug-resistant variants. |
Chain | A |
Resolution | 1.95 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MZ5 |
A |
D25 G27 A28 G48 |
D25 G27 A28 G48 |
PDBbind-CN: -logKd/Ki=10.20,Ki=0.063nM |
|
|
|