Structure of PDB 2qdw Chain A |
>2qdwA (length=105) Species: 266 (Paracoccus denitrificans) [Search protein sequence] |
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREA APHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRG KVVVE |
|
PDB | 2qdw A single methionine residue dictates the kinetic mechanism of interprotein electron transfer from methylamine dehydrogenase to amicyanin. |
Chain | A |
Resolution | 0.92 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
H53 C92 H95 |
Catalytic site (residue number reindexed from 1) |
H53 C92 H95 |
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU1 |
A |
H53 C92 H95 |
H53 C92 H95 |
|
|
|
|