Structure of PDB 2qd6 Chain A |
>2qd6A (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGV GGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF |
|
PDB | 2qd6 Potent new antiviral compound shows similar inhibition and structural interactions with drug resistant mutants and wild type HIV-1 protease. |
Chain | A |
Resolution | 1.28 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
065 |
A |
D25 A28 D30 P81 |
D25 A28 D30 P81 |
PDBbind-CN: -logKd/Ki=8.68,Ki=2.1nM |
|
|
|