Structure of PDB 2qby Chain A

Receptor sequence

>2qbyA (length=366) Species: 2287 (Saccharolobus solfataricus)

IFINREYLLPDYIPDELPHREDQIRKIASILAPLYREEKPNNIFIYGLTG
TGKTAVVKFVLSKLHKKFLGKFKHVYINTRQIDTPYRVLADLLESLDVKV
PFTGLSIAELYRRLVKAVRDYGSQVVIVLDEIDAFVKKYNDDILYKLSRI
NSEVNKISFIGITNDVKFVDLLDPRVKSSLSEEEIIFPPYNAEELEDILT
KRAQMAFKPGVLPDNVIKLCAALAAREHGDARRALDLLRVSGEIAERMKD
TKVKEEYVYMAKEEIERDRVRDIILTLPFHSKLVLMAVVSISVSTTGAVY
ETYLNICKKLGVEAVTQRRVSDIINELDMVGILTAKVVNRGRYGKTKEIG
LAVDKNIIVRSLIESD

3D structure

• PDB: 2qby Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
• Chain: A
• Resolution: 3.35 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	S122 I123 T319 G320 R341 S344 V360 R365 Y366 G367 K368 T369 K370	S106 I107 T296 G297 R318 S321 V337 R342 Y343 G344 K345 T346 K347
BS02	dna	A	V338 T339 R341 R342 N362 G364 R365	V315 T316 R318 R319 N339 G341 R342
BS03	ADP	A	L33 P34 G66 G68 K69 T70 A71 Y208 I216 R220 R250	L17 P18 G50 G52 K53 T54 A55 Y190 I198 R202 R232

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016887 ATP hydrolysis activity

Biological Process

• GO:0006260 DNA replication

External links

• PDB: RCSB:2qby, PDBe:2qby, PDBj:2qby
• PDBsum: 2qby
• PubMed: 17761879
• UniProt: Q980N4|CDC61_SACS2 ORC1-type DNA replication protein 1 (Gene Name=cdc6-1)