Structure of PDB 2q7r Chain A

Receptor sequence

>2q7rA (length=140) Species: 9606 (Homo sapiens) [Search protein sequence]

MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAF
ERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVG
YLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFG

3D structure

PDB

2q7r Crystal structure of inhibitor-bound human 5-lipoxygenase-activating protein.

Chain

Resolution

4.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	3CS	A	D62 K116 I119 L120 F123	D62 K116 I119 L120 F123
BS02	3CS	A	N23 G24 F25 A27	N23 G24 F25 A27

Gene Ontology

	Molecular Function
GO:0004051	arachidonate 5-lipoxygenase activity
GO:0004364	glutathione transferase activity
GO:0004464	leukotriene-C4 synthase activity
GO:0004602	glutathione peroxidase activity
GO:0005515	protein binding
GO:0008047	enzyme activator activity
GO:0019899	enzyme binding
GO:0042802	identical protein binding
GO:0044877	protein-containing complex binding
GO:0050544	arachidonate binding

	Biological Process
GO:0002540	leukotriene production involved in inflammatory response
GO:0002675	positive regulation of acute inflammatory response
GO:0006691	leukotriene metabolic process
GO:0019370	leukotriene biosynthetic process
GO:0019372	lipoxygenase pathway
GO:0070207	protein homotrimerization
GO:0071277	cellular response to calcium ion
GO:0098869	cellular oxidant detoxification

	Cellular Component
GO:0005634	nucleus
GO:0005635	nuclear envelope
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0016020	membrane
GO:0031965	nuclear membrane

External links

PDB	RCSB:2q7r, PDBe:2q7r, PDBj:2q7r
PDBsum	2q7r
PubMed	17600184
UniProt	P20292\|AL5AP_HUMAN Arachidonate 5-lipoxygenase-activating protein (Gene Name=ALOX5AP)