Structure of PDB 2q31 Chain A

Receptor sequence
>2q31A (length=335) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
TTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPTLKYPIEHGIITNWDD
MEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPA
MYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLA
GRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAA
SSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNS
IMKCDIDIRKDLYANNVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIA
PPERKYSVWIGGSILASLSTFQQMWITKQEYDEAG
3D structure
PDB2q31 Multiple crystal structures of actin dimers and their implications for interactions in the actin filament.
ChainA
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.4.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP A G13 S14 G15 K18 G156 D157 G158 V159 R210 K213 E214 G302 M305 Y306 K336 G9 S10 G11 K14 G125 D126 G127 V128 R179 K182 E183 G271 M274 Y275 K305
BS02 LAR A L16 Y69 D157 R183 T186 R206 E207 R210 L12 Y38 D126 R152 T155 R175 E176 R179
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003785 actin monomer binding
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0005523 tropomyosin binding
GO:0005524 ATP binding
GO:0016787 hydrolase activity
GO:0019904 protein domain specific binding
GO:0031013 troponin I binding
GO:0031432 titin binding
GO:0032036 myosin heavy chain binding
GO:0042802 identical protein binding
GO:0048306 calcium-dependent protein binding
GO:0140660 cytoskeletal motor activator activity
Biological Process
GO:0010628 positive regulation of gene expression
GO:0030041 actin filament polymerization
GO:0030240 skeletal muscle thin filament assembly
GO:0048741 skeletal muscle fiber development
GO:0051017 actin filament bundle assembly
GO:0090131 mesenchyme migration
Cellular Component
GO:0001725 stress fiber
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005865 striated muscle thin filament
GO:0005884 actin filament
GO:0030027 lamellipodium
GO:0030175 filopodium
GO:0031941 filamentous actin
GO:0032432 actin filament bundle
GO:0044297 cell body
GO:0098723 skeletal muscle myofibril

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2q31, PDBe:2q31, PDBj:2q31
PDBsum2q31
PubMed18391412
UniProtP68135|ACTS_RABIT Actin, alpha skeletal muscle (Gene Name=ACTA1)

[Back to BioLiP]