Structure of PDB 2q2t Chain A

Receptor sequence

>2q2tA (length=293) Species: 10506 (Paramecium bursaria Chlorella virus 1) [Search protein sequence]

MAITKPLLAATLENIEDVQFPCLATPKIDGIRSVKQTQMLSRTFKPIRNS
VMNRLLTELLPEGSDGEISIEGATFQDTTSAVMTGHKMYNAKFSYYWFDY
VTDDPLKKYIDRVEDMKNYITVHPHILEHAQVKIIPLIPVEINNITELLQ
YERDVLSKGFEGVMIRKPDGKYKFGRSTLKEGILLKMKQFKDAEATIISM
TALFKNTNTKTKDNFGYSKRSTHKSGKVEEDVMGSIEVDYDGVVFSIGTG
FDADQRRDFWQNKESYIGKMVKFKYFEMGSKDCPRFPVFIGIR

3D structure

PDB

2q2t Structural basis for nick recognition by a minimal pluripotent DNA ligase.

Chain

Resolution

2.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	S80 M83 T84 G85 K173 T178 K180 L203 F204 K205 N206 Y217 S218 R220 G234 S235 F245 S246 G248 K281 C283 F286	S80 M83 T84 G85 K173 T178 K180 L203 F204 K205 N206 Y217 S218 R220 G234 S235 F245 S246 G248 K281 C283 F286
BS02	dna	A	G30 I31 R32 S41 R42 T43 K45 F75 T79 M83 S221 T222 H223 K224	G30 I31 R32 S41 R42 T43 K45 F75 T79 M83 S221 T222 H223 K224
BS03	dna	A	R176 K186 K188 T249 F251 D252 A253 K274 F286 V288	R176 K186 K188 T249 F251 D252 A253 K274 F286 V288
BS04	AMP	A	T25 K27 I28 E67 F98 M164 K186 K188	T25 K27 I28 E67 F98 M164 K186 K188

Gene Ontology

	Molecular Function
GO:0000166	nucleotide binding
GO:0003909	DNA ligase activity
GO:0003910	DNA ligase (ATP) activity
GO:0005524	ATP binding
GO:0016874	ligase activity

	Biological Process
GO:0006260	DNA replication
GO:0006281	DNA repair
GO:0006310	DNA recombination

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2q2t, PDBe:2q2t, PDBj:2q2t
PDBsum	2q2t
PubMed	17618295
UniProt	O41026

[Back to BioLiP]