Structure of PDB 2q0l Chain A

Receptor sequence

>2q0lA (length=311) Species: 85962 (Helicobacter pylori 26695)

MIDCAIIGGGPAGLSAGLYATRGGVKNAVLFEKGMPGGQITGSSEIENYP
GVKEVVSGLDFMQPWQEQCFRFGLKHEMTAVQRVSKKDSHFVILAEDGKT
FEAKSVIIATGGSPKRTGIKGESEYWGKGVSTCATCDGFFYKNKEVAVLG
GGDTAVEEAIYLANICKKVYLIHRRDGFRCAPITLEHAKNNDKIEFLTPY
VVEEIKGDASGVSSLSIKNTATNEKRELVVPGFFIFVGYDVNNAVLKQED
NSMLCKCDEYGSIVVDFSMKTNVQGLFAAGDIRIFAPKQVVCAASDGATA
ALSVISYLEHH

3D structure

• PDB: 2q0l High-resolution structures of oxidized and reduced thioredoxin reductase from Helicobacter pylori.
• Chain: A
• Resolution: 1.45 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C133 C136 D137
• Catalytic site (residue number reindexed from 1): C133 C136 D137
• Enzyme Commision number: 1.8.1.9: thioredoxin-disulfide reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	G8 G10 P11 A12 E32 K33 G38 Q39 I40 N48 V81 T110 G111 C133 C136 G280 D281 K288 Q289 V290	G8 G10 P11 A12 E32 K33 G38 Q39 I40 N48 V81 T110 G111 C133 C136 G280 D281 K288 Q289 V290
BS02	NAP	A	G151 G152 D153 T154 E157 H173 R174 R175 R179 V237 G238 Y260	G151 G152 D153 T154 E157 H173 R174 R175 R179 V237 G238 Y260

Gene Ontology

Molecular Function

• GO:0004791 thioredoxin-disulfide reductase (NADPH) activity
• GO:0016491 oxidoreductase activity

Biological Process

• GO:0019430 removal of superoxide radicals
• GO:0045454 cell redox homeostasis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2q0l, PDBe:2q0l, PDBj:2q0l
• PDBsum: 2q0l
• PubMed: 17582174
• UniProt: P56431|TRXB_HELPY Thioredoxin reductase (Gene Name=trxB)