Structure of PDB 2pv0 Chain A

Receptor sequence
>2pv0A (length=347) Species: 9606 (Homo sapiens) [Search protein sequence]
GRDLIAYEVKANQRNIEDICICCGSLQVHTQHPLFEGGICAPCKDKFLDA
LFLYDDDGYQSYCSICCSGETLLICGNPDCTRCYCFECVDSLVGPGTSGK
VHAMSNWVCYLCLPSSRSGLLQRRRKWRSQLKAFYDRESENPLEMFETVP
VWRRQPVRVLSLFEDIKKELTSLGFLESGSDPGQLKHVVDVTDTVRKDVE
EWGPFDLVYGATPPLGHTCDRPPSWYLFQFHRLLQYARPKPGSPGPFFWM
FVDNLVLNKEDLDVASRFLEMEPVTIPDVHGGSLQNAVRVWSNIPAIRSR
HWALVSEEELSLLAQNKQSSKLAAKWPTKLVKNCFLPLREYFKYFST
3D structure
PDB2pv0 DNMT3L connects unmethylated lysine 4 of histone H3 to de novo methylation of DNA.
ChainA
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A C96 C99 C118 C121 C63 C66 C85 C88
BS02 ZN A C108 C113 C142 C145 C75 C80 C109 C112
BS03 ZN A C53 C56 C73 C76 C20 C23 C40 C43
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0008047 enzyme activator activity
GO:0019899 enzyme binding
GO:0046872 metal ion binding
GO:0051718 DNA (cytosine-5-)-methyltransferase activity, acting on CpG substrates
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0001890 placenta development
GO:0006346 DNA methylation-dependent heterochromatin formation
GO:0007141 male meiosis I
GO:0007283 spermatogenesis
GO:0010468 regulation of gene expression
GO:0010558 negative regulation of macromolecule biosynthetic process
GO:0030154 cell differentiation
GO:0032259 methylation
GO:0044726 epigenetic programing of female pronucleus
GO:0045814 negative regulation of gene expression, epigenetic
GO:0048863 stem cell differentiation
GO:0060718 chorionic trophoblast cell differentiation
GO:0071514 genomic imprinting
GO:0090310 negative regulation of DNA methylation-dependent heterochromatin formation
GO:0141005 retrotransposon silencing by heterochromatin formation
GO:0141068 autosome genomic imprinting
GO:0141196 retrotransposon silencing by piRNA-directed DNA methylation
Cellular Component
GO:0000792 heterochromatin
GO:0000794 condensed nuclear chromosome
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0035098 ESC/E(Z) complex
GO:1902494 catalytic complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2pv0, PDBe:2pv0, PDBj:2pv0
PDBsum2pv0
PubMed17687327
UniProtQ9UJW3|DNM3L_HUMAN DNA (cytosine-5)-methyltransferase 3-like (Gene Name=DNMT3L)

[Back to BioLiP]