Structure of PDB 2pmi Chain A

Receptor sequence
>2pmiA (length=284) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
ATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHENIVRL
YDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLL
QGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFSSE
VVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQL
KLIFDIMGTPNESLWPSVTKLPKYNPNIQQRPPRDLRQVLQPHTKEPLDG
NLMDFLHGLLQLNPDMRLSAKQALHHPWFAEYYH
3D structure
PDB2pmi Structure of the Pho85-Pho80 CDK-Cyclin Complex of the Phosphate-Responsive Signal Transduction Pathway
ChainA
Resolution2.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D133 K135 Q137 N138 D151 T164 T171
Catalytic site (residue number reindexed from 1) D115 K117 Q119 N120 D133 T146 T153
Enzyme Commision number 2.7.11.22: cyclin-dependent kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 AGS A V21 A34 K36 M85 D151 V3 A16 K18 M67 D133
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0004693 cyclin-dependent protein serine/threonine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0106310 protein serine kinase activity
Biological Process
GO:0000082 G1/S transition of mitotic cell cycle
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0001676 long-chain fatty acid metabolic process
GO:0005979 regulation of glycogen biosynthetic process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006468 protein phosphorylation
GO:0006974 DNA damage response
GO:0009891 positive regulation of biosynthetic process
GO:0016239 positive regulation of macroautophagy
GO:0016242 negative regulation of macroautophagy
GO:0016310 phosphorylation
GO:0019216 regulation of lipid metabolic process
GO:0030952 establishment or maintenance of cytoskeleton polarity
GO:0031505 fungal-type cell wall organization
GO:0031647 regulation of protein stability
GO:0031648 protein destabilization
GO:0032878 regulation of establishment or maintenance of cell polarity
GO:0032880 regulation of protein localization
GO:0044843 cell cycle G1/S phase transition
GO:0045719 negative regulation of glycogen biosynthetic process
GO:0045936 negative regulation of phosphate metabolic process
GO:0046822 regulation of nucleocytoplasmic transport
GO:0050849 negative regulation of calcium-mediated signaling
GO:0051302 regulation of cell division
GO:0051726 regulation of cell cycle
GO:0055088 lipid homeostasis
GO:0071073 positive regulation of phospholipid biosynthetic process
GO:1901987 regulation of cell cycle phase transition
Cellular Component
GO:0000307 cyclin-dependent protein kinase holoenzyme complex
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005935 cellular bud neck
GO:1902554 serine/threonine protein kinase complex
GO:1990860 Pho85-Pho80 CDK-cyclin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2pmi, PDBe:2pmi, PDBj:2pmi
PDBsum2pmi
PubMed18042456
UniProtP17157|PHO85_YEAST Cyclin-dependent protein kinase PHO85 (Gene Name=PHO85)

[Back to BioLiP]