Structure of PDB 2pij Chain A |
>2pijA (length=59) Species: 220664 (Pseudomonas protegens Pf-5) [Search protein sequence] |
MKKIPLSKYLEEHGTQSALAAALGVNQSAISQMVRAGRSIEITLYEDGRV EANEIRPIP |
|
PDB | 2pij Transitive homology-guided structural studies lead to discovery of Cro proteins with 40% sequence identity but different folds. |
Chain | A |
Resolution | 1.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
BCT |
A |
Q27 S28 |
Q27 S28 |
|
|
|
|