Structure of PDB 2pgh Chain A

Receptor sequence

>2pghA (length=141) Species: 9823 (Sus scrofa)

VLSAADKANVKAAWGKVGGQAGAHGAEALERMFLGFPTTKTYFPHFNLSH
GSDQVKAHGQKVADALTKAVGHLDDLPGALSALSDLHAHKLRVDPVNFKL
LSHCLLVTLAAHHPDDFNPSVHASLDKFLANVSTVLTSKYR

3D structure

• PDB: 2pgh Structure determination of aquomet porcine hemoglobin at 2.8 A resolution.
• Chain: A
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	F43 H58 L83 H87 L91 V93 N97 F98 L101 L136	F43 H58 L83 H87 L91 V93 N97 F98 L101 L136

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0005506 iron ion binding
• GO:0005515 protein binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex

External links

• PDB: RCSB:2pgh, PDBe:2pgh, PDBj:2pgh
• PDBsum: 2pgh
• PubMed: 7990139
• UniProt: P01965|HBA_PIG Hemoglobin subunit alpha (Gene Name=HBA)